General Information

  • ID:  hor005680
  • Uniprot ID:  P51694
  • Protein name:  Peptide YY
  • Gene name:  PYY
  • Organism:  Bos taurus (Bovine)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YPAKPQAPGEHASPDELNRYYTSLRHYLNLVTRQRF
  • Length:  36(29-64)
  • Propeptide:  MMSGRRSWPAMATVLLTLLVCLGELVDAYPAKPQAPGEHASPDELNRYYTSLRHYLNLVTRQRFGKRDFSEALLSILLFPDREDPPVKSRPEGAYLW
  • Signal peptide:  MMSGRRSWPAMATVLLTLLVCLGELVDA
  • Modification:  T13 Phosphoserine;T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51694-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005680_AF2.pdbhor005680_ESM.pdb

Physical Information

Mass: 491423 Formula: C193H291N57O55
Absent amino acids: CIMW Common amino acids: LPRY
pI: 9.63 Basic residues: 7
Polar residues: 11 Hydrophobic residues: 9
Hydrophobicity: -111.67 Boman Index: -10068
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 59.72
Instability Index: 5790 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  7831336
  • Title:  Seminalplasmin: recent evolution of another member of the neuropeptide Y gene family.